PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v2002350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 353aa    MW: 41113.6 Da    PI: 6.7579
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v2002350.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.83.6e-5671361129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeelv++yL+kkv++k++el +vik+vd+yk+ePwdL++  k+ + e++ewyfFs++dkky+tg+r+nratk+g+Wkatg+dk+
  Lj2g3v2002350.1   7 VPPGFRFHPTDEELVDHYLRKKVASKRIEL-DVIKDVDLYKIEPWDLQElcKLGTdEQNEWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKS 99 
                      69****************************.9***************954544443556*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +++ k+ lvg++ktLvfykgrap+g+k+dW+mheyrle
  Lj2g3v2002350.1 100 IYT-KHCLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                      ***.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-615157IPR003441NAC domain
PROSITE profilePS5100559.5677157IPR003441NAC domain
PfamPF023654.7E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MNTFSHVPPG FRFHPTDEEL VDHYLRKKVA SKRIELDVIK DVDLYKIEPW DLQELCKLGT  60
DEQNEWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKSI YTKHCLVGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GSTPQEEGWA VCKVFKKRMP TTIRKMGDYG SPCWYDDQVS  180
FMQELESPNQ VSSHHYASYQ QQQHYPCKQE LEMQYNVTRT HDAFLQLPQL ESPKLLQSYG  240
YDHGNNNNGS ILQSSSSSLP QQEEHIQHGQ HQSLQHLLYG SNNDQVTDWR VLDKFVASQL  300
SHEQHASKDE TSYSNVAEDQ EQFTLLPNGS EKPEINQKYA STTTSSCQID PWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-51615814169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039928.10.0NAC domain protein, IPR003441 isoform 1
SwissprotQ9FWX21e-146NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A061GBJ70.0A0A061GBJ7_THECC; NAC domain protein, IPR003441 isoform 1
STRINGVIT_02s0154g00020.t011e-180(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-139NAC 007